Lineage for d4az4a_ (4az4 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606866Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 2606867Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 2606868Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
    automatically mapped to Pfam PF01327
  6. 2606994Protein automated matches [190200] (10 species)
    not a true protein
  7. 2607014Species Escherichia coli [TaxId:469008] [194798] (3 PDB entries)
  8. 2607015Domain d4az4a_: 4az4 A: [194799]
    automated match to d1bs4a_
    complexed with co, h2s

Details for d4az4a_

PDB Entry: 4az4 (more details), 1.8 Å

PDB Description: e.coli deformylase with co(ii) and hydrosulfide
PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d4az4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4az4a_ d.167.1.1 (A:) automated matches {Escherichia coli [TaxId: 469008]}
svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldr

SCOPe Domain Coordinates for d4az4a_:

Click to download the PDB-style file with coordinates for d4az4a_.
(The format of our PDB-style files is described here.)

Timeline for d4az4a_: