SCOPe 2.02: Domain d4efvb_: 4efv B:

Lineage for d4efvb_ (4efv B:)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.3: Neurotrophin [57520] (5 proteins)

6. Protein automated matches [190424] (4 species)
   not a true protein

7. Species Lama glama [TaxId:9844] [194795] (1 PDB entry)

8. Domain d4efvb_: 4efv B: [194796]
   automated match to d1wwww_
   complexed with cl, po4

Details for d4efvb_

PDB Entry: 4efv, 2.32 Å

PDB Description: Crystal structure of OIF from Llama seminal plasma

PDB Compounds: (B:) Ovulation-inducing factor (OIF)

SCOPe Domain Sequences for d4efvb_:

Sequence; same for both SEQRES and ATOM records:

>d4efvb_ g.17.1.3 (B:) automated matches {Lama glama [TaxId: 9844]}
gefsvcdsvsvwvadkttatdikgkevmvlgevninnsvfkqyffetkcrdpnpvasgcr
gidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlskkas

Timeline for d4efvb_:

• d4efvb_ is new in SCOPe 2.02-stable
  
• d4efvb_ appears in SCOPe 2.03
  
• d4efvb_ appears in the current release, SCOPe 2.08