Lineage for d4ff7b_ (4ff7 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089715Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2089716Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 2089717Protein Triosephosphate isomerase [51353] (20 species)
  7. 2089723Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51356] (8 PDB entries)
  8. 2089731Domain d4ff7b_: 4ff7 B: [194793]
    automated match to d7tima_
    complexed with gol, na, pga, po4, so4; mutant

Details for d4ff7b_

PDB Entry: 4ff7 (more details), 1.86 Å

PDB Description: Structure of C126S mutant of Saccharomyces cerevisiae triosephosphate isomerase
PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d4ff7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ff7b_ c.1.1.1 (B:) Triosephosphate isomerase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
artffvggnfklngskqsikeiverlntasipenvevvicppatyldysvslvkkpqvtv
gaqnaylkasgaftgensvdqikdvgakwvilghserrsyfheddkfiadktkfalgqgv
gvilsigetleekkagktldvverqlnavleevkdwtnvvvayepvwaigtglaatpeda
qdihasirkflasklgdkaaselrilyggsangsnavtfkdkadvdgflvggaslkpefv
diinsrn

SCOPe Domain Coordinates for d4ff7b_:

Click to download the PDB-style file with coordinates for d4ff7b_.
(The format of our PDB-style files is described here.)

Timeline for d4ff7b_: