Lineage for d4fhrb1 (4fhr B:115-327)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727358Superfamily a.118.14: FliG [48029] (2 families) (S)
    fragmented superhelix; consist of 3/4-helical motifs and connecting helices
  5. 2727359Family a.118.14.1: FliG [48030] (2 proteins)
  6. 2727360Protein FliG [48031] (1 species)
  7. 2727361Species Thermotoga maritima [TaxId:2336] [48032] (3 PDB entries)
  8. 2727362Domain d4fhrb1: 4fhr B:115-327 [194792]
    Other proteins in same PDB: d4fhrb2
    automated match to d1lkvx_

Details for d4fhrb1

PDB Entry: 4fhr (more details), 1.93 Å

PDB Description: Crystal structure of the complex between the flagellar motor proteins FliG and FliM.
PDB Compounds: (B:) Flagellar motor switch protein fliG

SCOPe Domain Sequences for d4fhrb1:

Sequence, based on SEQRES records: (download)

>d4fhrb1 a.118.14.1 (B:115-327) FliG {Thermotoga maritima [TaxId: 2336]}
dpvqlvnflqsehpqtiavvlsyldppvaaqilgalpeelqtevlkriallertspevvk
eiernlekkisgfvsrtfskvggidtaaeimnnldrttekkimdklvqenpeladeirrr
mfvfedilklddrsiqlvlrevdtrdlalalkgasdelkekifknmskraaallkdeley
mgpvrlkdveeaqqkiiniirrleeageiviar

Sequence, based on observed residues (ATOM records): (download)

>d4fhrb1 a.118.14.1 (B:115-327) FliG {Thermotoga maritima [TaxId: 2336]}
dpvqlvnflqsehpqtiavvlsyldppvaaqilgalpeelqtevlkriallertspevvk
eiernlekkisgfvggidtaaeimnnldrttekkimdklvqenpeladeirrrmfvfedi
lklddrsiqlvlrevdtrdlalalkgasdelkekifknmskraaallkdeleymgpvrlk
dveeaqqkiiniirrleeageiviar

SCOPe Domain Coordinates for d4fhrb1:

Click to download the PDB-style file with coordinates for d4fhrb1.
(The format of our PDB-style files is described here.)

Timeline for d4fhrb1: