SCOPe 2.05: Domain d4fnha_: 4fnh A:

Lineage for d4fnha_ (4fnh A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.5: PG130-like [102959] (6 proteins)
   subfamily of Pfam PF03992

6. Protein Hypothetical protein PG130 (SAV0165) [110955] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [110956] (7 PDB entries)
   Uniprot Q99X56

8. Domain d4fnha_: 4fnh A: [194791]
   automated match to d2zdpa_
   complexed with hem

Details for d4fnha_

PDB Entry: 4fnh, 1.9 Å

PDB Description: Crystal structure of IsdI-W66Y in complex with heme

PDB Compounds: (A:) Heme-degrading monooxygenase isdI

SCOPe Domain Sequences for d4fnha_:

Sequence; same for both SEQRES and ATOM records:

>d4fnha_ d.58.4.5 (A:) Hypothetical protein PG130 (SAV0165) {Staphylococcus aureus [TaxId: 1280]}
ahmfmaenrlqlqkgsaeetierfynrqgietiegfqqmfvtktlntedtdevkiltiwe
sedsfnnylnsdvfkeahknvrlksdddgqqspilsnkvfkydigyhyqk

Timeline for d4fnha_:

• d4fnha_ first appeared in SCOPe 2.02
  
• d4fnha_ appears in SCOPe 2.04
  
• d4fnha_ is called d4fnha1 in SCOPe 2.06
  
• d4fnha_ appears in the current release, SCOPe 2.08, called d4fnha1