Lineage for d4gj1a_ (4gj1 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079793Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2079794Protein automated matches [190292] (34 species)
    not a true protein
  7. 2079824Species Campylobacter jejuni [TaxId:192222] [194783] (4 PDB entries)
  8. 2079829Domain d4gj1a_: 4gj1 A: [194784]
    automated match to d2x30a_

Details for d4gj1a_

PDB Entry: 4gj1 (more details), 2.15 Å

PDB Description: crystal structure of 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide isomerase (hisa).
PDB Compounds: (A:) 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase

SCOPe Domain Sequences for d4gj1a_:

Sequence, based on SEQRES records: (download)

>d4gj1a_ c.1.2.0 (A:) automated matches {Campylobacter jejuni [TaxId: 192222]}
tqiipaldlidgevvrlvkgdyeqkkvykynplkkfkeyekagakelhlvdltgakdpsk
rqfalieklakevsvnlqvgggirskeevkalldcgvkrvvigsmaikdatlcleilkef
gseaivlaldtilkedyvvavnawqeasdkklmevldfysnkglkhilctdiskdgtmqg
vnvrlykliheifpniciqasggvaslkdlenlkgicsgvivgkalldgvfsveegircl
an

Sequence, based on observed residues (ATOM records): (download)

>d4gj1a_ c.1.2.0 (A:) automated matches {Campylobacter jejuni [TaxId: 192222]}
tqiipaldlidgevvrlvkgdyeqkkvykynplkkfkeyekagakelhlvdltgakdpsk
rqfalieklakevsvnlqvgggirskeevkalldcgvkrvvigsmaikdatlcleilkef
gseaivlaldtilkedyvvadkklmevldfysnkglkhilctdiskgvnvrlykliheif
pniciqasggvaslkdlenlkgicsgvivgkalldgvfsveegirclan

SCOPe Domain Coordinates for d4gj1a_:

Click to download the PDB-style file with coordinates for d4gj1a_.
(The format of our PDB-style files is described here.)

Timeline for d4gj1a_: