Lineage for d1aonf1 (1aon F:2-136,F:410-525)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 51151Fold a.129: GroEL-like chaperones, ATPase domain [48591] (1 superfamily)
  4. 51152Superfamily a.129.1: GroEL-like chaperones, ATPase domain [48592] (2 families) (S)
  5. 51153Family a.129.1.1: GroEL [48593] (1 protein)
  6. 51154Protein GroEL [48594] (1 species)
  7. 51155Species Escherichia coli [TaxId:562] [48595] (4 PDB entries)
  8. 51182Domain d1aonf1: 1aon F:2-136,F:410-525 [19478]
    Other proteins in same PDB: d1aona2, d1aona3, d1aonb2, d1aonb3, d1aonc2, d1aonc3, d1aond2, d1aond3, d1aone2, d1aone3, d1aonf2, d1aonf3, d1aong2, d1aong3, d1aonh2, d1aonh3, d1aoni2, d1aoni3, d1aonj2, d1aonj3, d1aonk2, d1aonk3, d1aonl2, d1aonl3, d1aonm2, d1aonm3, d1aonn2, d1aonn3, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_

Details for d1aonf1

PDB Entry: 1aon (more details), 3 Å

PDB Description: crystal structure of the asymmetric chaperonin complex groel/groes/(adp)7

SCOP Domain Sequences for d1aonf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aonf1 a.129.1.1 (F:2-136,F:410-525) GroEL {Escherichia coli}
aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
kavtaaveelkalsvXgvvagggvalirvaskladlrgqnedqnvgikvalrameaplrq
ivlncgeepsvvantvkggdgnygynaateeygnmidmgildptkvtrsalqyaasvagl
mittecmvtdlp

SCOP Domain Coordinates for d1aonf1:

Click to download the PDB-style file with coordinates for d1aonf1.
(The format of our PDB-style files is described here.)

Timeline for d1aonf1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1aona1, d1aona2, d1aona3, d1aonb1, d1aonb2, d1aonb3, d1aonc1, d1aonc2, d1aonc3, d1aond1, d1aond2, d1aond3, d1aone1, d1aone2, d1aone3, d1aong1, d1aong2, d1aong3, d1aonh1, d1aonh2, d1aonh3, d1aoni1, d1aoni2, d1aoni3, d1aonj1, d1aonj2, d1aonj3, d1aonk1, d1aonk2, d1aonk3, d1aonl1, d1aonl2, d1aonl3, d1aonm1, d1aonm2, d1aonm3, d1aonn1, d1aonn2, d1aonn3, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_