SCOPe 2.07: Domain d3uf5b_: 3uf5 B:

Lineage for d3uf5b_ (3uf5 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein automated matches [190501] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187941] (5 PDB entries)

8. Domain d3uf5b_: 3uf5 B: [194778]
   automated match to d3ejja_
   complexed with ca

Details for d3uf5b_

PDB Entry: 3uf5, 2.8 Å

PDB Description: Crystal structure of the mouse Colony-Stimulating Factor 1 (mCSF-1) cytokine

PDB Compounds: (B:) macrophage colony-stimulating factor 1

SCOPe Domain Sequences for d3uf5b_:

Sequence, based on SEQRES records:

>d3uf5b_ a.26.1.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kevsehcshmignghlkvlqqlidsqmetscqiafefvdqeqlddpvcylkkafflvqdi
idetmrfkdntpnanaterlqelsnnlnscftkdyeeqnkacvrtfhetplqllekiknf
fnetknllekdwniftkncnnsfakc

Sequence, based on observed residues (ATOM records):

>d3uf5b_ a.26.1.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kevsehcshmignghlkvlqqlidsqmetscqiafefvdqeqlddpvcylkkafflvqdi
idetmrfkdntpnanaterlqelsnnlnscftkdyenkacvrtfhetplqllekiknffn
etknllekdwniftkncnnsfakc

Timeline for d3uf5b_:

• d3uf5b_ first appeared in SCOPe 2.02
  
• d3uf5b_ appears in SCOPe 2.06
  
• d3uf5b_ appears in the current release, SCOPe 2.08