Lineage for d3uf5b_ (3uf5 B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1085916Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1085917Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1085997Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 1086124Protein automated matches [190501] (2 species)
    not a true protein
  7. 1086141Species Mouse (Mus musculus) [TaxId:10090] [187941] (5 PDB entries)
  8. 1086145Domain d3uf5b_: 3uf5 B: [194778]
    automated match to d3ejja_
    complexed with ca

Details for d3uf5b_

PDB Entry: 3uf5 (more details), 2.8 Å

PDB Description: Crystal structure of the mouse Colony-Stimulating Factor 1 (mCSF-1) cytokine
PDB Compounds: (B:) macrophage colony-stimulating factor 1

SCOPe Domain Sequences for d3uf5b_:

Sequence, based on SEQRES records: (download)

>d3uf5b_ a.26.1.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kevsehcshmignghlkvlqqlidsqmetscqiafefvdqeqlddpvcylkkafflvqdi
idetmrfkdntpnanaterlqelsnnlnscftkdyeeqnkacvrtfhetplqllekiknf
fnetknllekdwniftkncnnsfakc

Sequence, based on observed residues (ATOM records): (download)

>d3uf5b_ a.26.1.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kevsehcshmignghlkvlqqlidsqmetscqiafefvdqeqlddpvcylkkafflvqdi
idetmrfkdntpnanaterlqelsnnlnscftkdyenkacvrtfhetplqllekiknffn
etknllekdwniftkncnnsfakc

SCOPe Domain Coordinates for d3uf5b_:

Click to download the PDB-style file with coordinates for d3uf5b_.
(The format of our PDB-style files is described here.)

Timeline for d3uf5b_: