![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
![]() | Protein automated matches [190501] (4 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [187941] (5 PDB entries) |
![]() | Domain d3uf5b_: 3uf5 B: [194778] automated match to d3ejja_ complexed with ca |
PDB Entry: 3uf5 (more details), 2.8 Å
SCOPe Domain Sequences for d3uf5b_:
Sequence, based on SEQRES records: (download)
>d3uf5b_ a.26.1.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} kevsehcshmignghlkvlqqlidsqmetscqiafefvdqeqlddpvcylkkafflvqdi idetmrfkdntpnanaterlqelsnnlnscftkdyeeqnkacvrtfhetplqllekiknf fnetknllekdwniftkncnnsfakc
>d3uf5b_ a.26.1.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} kevsehcshmignghlkvlqqlidsqmetscqiafefvdqeqlddpvcylkkafflvqdi idetmrfkdntpnanaterlqelsnnlnscftkdyenkacvrtfhetplqllekiknffn etknllekdwniftkncnnsfakc
Timeline for d3uf5b_: