![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
![]() | Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (2 families) ![]() |
![]() | Family d.41.5.0: automated matches [191646] (1 protein) not a true family |
![]() | Protein automated matches [191185] (2 species) not a true protein |
![]() | Species Homo sapiens [TaxId:9606] [194767] (1 PDB entry) |
![]() | Domain d4ap8d_: 4ap8 D: [194770] automated match to d2wp4b_ complexed with edo, gol |
PDB Entry: 4ap8 (more details), 2.78 Å
SCOPe Domain Sequences for d4ap8d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ap8d_ d.41.5.0 (D:) automated matches {Homo sapiens [TaxId: 9606]} eekskdvinftaeklsvdevsqlvisplcgaislfvgttrnnfegkkvisleyeaylpma enevrkicsdirqkwpvkhiavfhrlglvpvseasiiiavssahraasleavsyaidtlk akvpiwkkeiyee
Timeline for d4ap8d_: