Lineage for d4ap8d_ (4ap8 D:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1201772Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 1202022Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (2 families) (S)
  5. 1202036Family d.41.5.0: automated matches [191646] (1 protein)
    not a true family
  6. 1202037Protein automated matches [191185] (2 species)
    not a true protein
  7. 1202038Species Homo sapiens [TaxId:9606] [194767] (1 PDB entry)
  8. 1202042Domain d4ap8d_: 4ap8 D: [194770]
    automated match to d2wp4b_
    complexed with edo, gol

Details for d4ap8d_

PDB Entry: 4ap8 (more details), 2.78 Å

PDB Description: crystal structure of human molybdopterin synthase catalytic subunit (mocs2b)
PDB Compounds: (D:) Molybdopterin synthase catalytic subunit

SCOPe Domain Sequences for d4ap8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ap8d_ d.41.5.0 (D:) automated matches {Homo sapiens [TaxId: 9606]}
eekskdvinftaeklsvdevsqlvisplcgaislfvgttrnnfegkkvisleyeaylpma
enevrkicsdirqkwpvkhiavfhrlglvpvseasiiiavssahraasleavsyaidtlk
akvpiwkkeiyee

SCOPe Domain Coordinates for d4ap8d_:

Click to download the PDB-style file with coordinates for d4ap8d_.
(The format of our PDB-style files is described here.)

Timeline for d4ap8d_: