SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4ap8d_ (4ap8 D:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2168779Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2169144Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (2 families) (S)
  5. 2169158Family d.41.5.0: automated matches [191646] (1 protein)
    not a true family
  6. 2169159Protein automated matches [191185] (4 species)
    not a true protein
  7. 2169163Species Human (Homo sapiens) [TaxId:9606] [194767] (2 PDB entries)
  8. 2169167Domain d4ap8d_: 4ap8 D: [194770]
    automated match to d2wp4b_
    complexed with edo, gol

Details for d4ap8d_

PDB Entry: 4ap8 (more details), 2.78 Å

PDB Description: Crystal structure of human Molybdopterin synthase catalytic subunit (MOCS2B)
PDB Compounds: (D:) Molybdopterin synthase catalytic subunit

SCOPe Domain Sequences for d4ap8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ap8d_ d.41.5.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eekskdvinftaeklsvdevsqlvisplcgaislfvgttrnnfegkkvisleyeaylpma
enevrkicsdirqkwpvkhiavfhrlglvpvseasiiiavssahraasleavsyaidtlk
akvpiwkkeiyee

SCOPe Domain Coordinates for d4ap8d_:

Click to download the PDB-style file with coordinates for d4ap8d_.
(The format of our PDB-style files is described here.)

Timeline for d4ap8d_: