| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (2 families) ![]() |
| Family d.41.5.0: automated matches [191646] (1 protein) not a true family |
| Protein automated matches [191185] (7 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [194767] (2 PDB entries) |
| Domain d4ap8c_: 4ap8 C: [194768] automated match to d2wp4b_ complexed with edo, gol |
PDB Entry: 4ap8 (more details), 2.78 Å
SCOPe Domain Sequences for d4ap8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ap8c_ d.41.5.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eveekskdvinftaeklsvdevsqlvisplcgaislfvgttrnnfegkkvisleyeaylp
maenevrkicsdirqkwpvkhiavfhrlglvpvseasiiiavssahraasleavsyaidt
lkakvpiwkkeiye
Timeline for d4ap8c_: