Lineage for d3b99b_ (3b99 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2006029Species Zebrafish (Danio rerio) [TaxId:7955] [194761] (4 PDB entries)
  8. 2006033Domain d3b99b_: 3b99 B: [194763]
    automated match to d3l4da_
    complexed with hem, u51

Details for d3b99b_

PDB Entry: 3b99 (more details), 2.5 Å

PDB Description: Crystal structure of zebrafish prostacyclin synthase (cytochrome P450 8A1) in complex with substrate analog U51605
PDB Compounds: (B:) Prostaglandin I2 synthase

SCOPe Domain Sequences for d3b99b_:

Sequence, based on SEQRES records: (download)

>d3b99b_ a.104.1.0 (B:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
rrtrrrneppldkgmipwlghalefgkdaakfltrmkekhgdiftvraaglyitvlldsn
cydavlsdvasldqtsyaqvlmkrifnmilpshnpesekkraemhfqgasltqlsnsmqn
nlrllmtpsemglktsewkkdglfnlcysllfktgyltvfgaennnsaaltqiyeefrrf
dkllpklarttvnkeekqiasaareklwkwltpsgldrkpreqswlgsyvkqlqdegida
emqrramllqlwvtqgnagpaafwvmgyllthpealravreeiqggkhlrleerqkntpv
fdsvlwetlrltaaalitrdvtqdkkiclsngqeyhlrrgdrlcvfpfispqmdpqihqq
pemfqfdrflnadrtekkdffkngarvkypsvpwgtednlcpgrhfavhaikelvftilt
rfdvelcdknatvplvdpsrygfgilqpagdleiryrir

Sequence, based on observed residues (ATOM records): (download)

>d3b99b_ a.104.1.0 (B:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
rrtrrrneppldkgmipwlghalefgkdaakfltrmkekhgdiftvraaglyitvlldsn
cydavlsdvasldqtsyaqvlmkrifnmilpshnpesekkraemhfqgasltqlsnsmqn
nlrllmtpsemwkkdglfnlcysllfktgyltvftqiyeefrrfdkllpklartekqias
aareklwkwltswlgsyvkqlqdegidaemqrramllqlwvtqgnagpaafwvmgyllth
pealravreeiqntpvfdsvlwetlrltaaalitrdvtqdkkiclsngqeyhlrrgdrlc
vfpfispqmdpqihqqpemfqfdrflnadrtekkdffkngarvkypsvpwgtednlcpgr
hfavhaikelvftiltrfdvelcdknatvplvdpsrygfgilqpagdleiryrir

SCOPe Domain Coordinates for d3b99b_:

Click to download the PDB-style file with coordinates for d3b99b_.
(The format of our PDB-style files is described here.)

Timeline for d3b99b_: