Lineage for d4fe3a1 (4fe3 A:12-297)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920211Family c.108.1.21: Pyrimidine 5'-nucleotidase (UMPH-1) [142183] (2 proteins)
    Pfam PF05822; the insertion subdomain is a rudiment 4-helical bundle
  6. 2920230Protein automated matches [190392] (2 species)
    not a true protein
  7. 2920234Species Mouse (Mus musculus) [TaxId:10090] [188220] (2 PDB entries)
  8. 2920235Domain d4fe3a1: 4fe3 A:12-297 [194760]
    Other proteins in same PDB: d4fe3a2
    automated match to d2g09a_
    complexed with bme, mg, na, u5p

Details for d4fe3a1

PDB Entry: 4fe3 (more details), 1.74 Å

PDB Description: Structure of murine cytosolic 5'-nucleotidase III complexed with uridinine monophosphate
PDB Compounds: (A:) Cytosolic 5'-nucleotidase 3

SCOPe Domain Sequences for d4fe3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fe3a1 c.108.1.21 (A:12-297) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mmpefqkssvriknptrveeiicglikggaaklqiitdfnmtlsrfsyngkrcptchnii
dncklvtdecrrkllqlkeqyyaievdpvltveekfpymvewytkshgllieqgipkakl
keivadsdvmlkegyenffgklqqhgipvfifsagigdvleevirqagvyhsnvkvvsnf
mdfdengvlkgfkgelihvfnkhdgalkntdyfsqlkdnsniillgdsqgdlrmadgvan
vehilkigylndrvdellekymdsydivlvkeeslevvnsilqktl

SCOPe Domain Coordinates for d4fe3a1:

Click to download the PDB-style file with coordinates for d4fe3a1.
(The format of our PDB-style files is described here.)

Timeline for d4fe3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4fe3a2