Lineage for d3tk0a_ (3tk0 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1726514Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1727259Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families) (S)
  5. 1727260Family a.24.15.1: FAD-dependent thiol oxidase [69001] (3 proteins)
  6. 1727261Protein Augmenter of liver regeneration [89018] (2 species)
    a mammalian FAD-dependent sulfhydryl oxidase
  7. 1727262Species Human (Homo sapiens) [TaxId:9606] [189907] (7 PDB entries)
  8. 1727263Domain d3tk0a_: 3tk0 A: [194758]
    automated match to d3o55a_
    complexed with fad; mutant

Details for d3tk0a_

PDB Entry: 3tk0 (more details), 1.61 Å

PDB Description: mutation of sfALR
PDB Compounds: (A:) FAD-linked sulfhydryl oxidase ALR

SCOPe Domain Sequences for d3tk0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tk0a_ a.24.15.1 (A:) Augmenter of liver regeneration {Human (Homo sapiens) [TaxId: 9606]}
smrtqqkrdtkfredcppdreelgrhswavlhtlaayypdlptpeqqqdmaqfihlfskf
ypseecaedlrkrlarnhpdtrtraaftqwlchlhnevnrklgkpdfdcskvderwrdgw
kdgscd

SCOPe Domain Coordinates for d3tk0a_:

Click to download the PDB-style file with coordinates for d3tk0a_.
(The format of our PDB-style files is described here.)

Timeline for d3tk0a_: