Lineage for d3vi8a_ (3vi8 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008932Protein Peroxisome proliferator activated receptor alpha, PPAR-alpha [69109] (1 species)
  7. 2008933Species Human (Homo sapiens) [TaxId:9606] [69110] (16 PDB entries)
  8. 2008934Domain d3vi8a_: 3vi8 A: [194751]
    automated match to d3kdub_
    complexed with 13m

Details for d3vi8a_

PDB Entry: 3vi8 (more details), 1.75 Å

PDB Description: human ppar alpha ligand binding domain in complex with a synthetic agonist aphm13
PDB Compounds: (A:) Peroxisome proliferator-activated receptor alpha

SCOPe Domain Sequences for d3vi8a_:

Sequence, based on SEQRES records: (download)

>d3vi8a_ a.123.1.1 (A:) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]}
dlkslakriyeaylknfnmnkvkarvilsgkasnnppfvihdmetlcmaektlvaklvan
giqnkeaevrifhccqctsvetvteltefakaipgfanldlndqvtllkygvyeaifaml
ssvmnkdgmlvaygngfitreflkslrkpfcdimepkfdfamkfnalelddsdislfvaa
iiccgdrpgllnvghiekmqegivhvlrlhlqsnhpddiflfpkllqkmadlrqlvteha
qlvqiikktesdaalhpllqeiyrdmy

Sequence, based on observed residues (ATOM records): (download)

>d3vi8a_ a.123.1.1 (A:) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]}
dlkslakriyeaylknfnmnkvkarvilspfvihdmetlcmaektlvaklvangnkeaev
rifhccqctsvetvteltefakaipgfanldlndqvtllkygvyeaifamlssvmnkdgm
lvaygngfitreflkslrkpfcdimepkfdfamkfnalelddsdislfvaaiiccgdrpg
llnvghiekmqegivhvlrlhlqsnhpddiflfpkllqkmadlrqlvtehaqlvqiikkt
esdaalhpllqeiyrdmy

SCOPe Domain Coordinates for d3vi8a_:

Click to download the PDB-style file with coordinates for d3vi8a_.
(The format of our PDB-style files is described here.)

Timeline for d3vi8a_: