SCOPe 2.08: Domain d2rk9b_: 2rk9 B:

Lineage for d2rk9b_ (2rk9 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (26 species)
   not a true protein

7. Species Vibrio splendidus [TaxId:314291] [194747] (1 PDB entry)

8. Domain d2rk9b_: 2rk9 B: [194748]
   automated match to d3fcda_

Details for d2rk9b_

PDB Entry: 2rk9, 1.6 Å

PDB Description: the crystal structure of a glyoxalase/bleomycin resistance protein/dioxygenase superfamily member from vibrio splendidus 12b01

PDB Compounds: (B:) Glyoxalase/bleomycin resistance protein/dioxygenase

SCOPe Domain Sequences for d2rk9b_:

Sequence, based on SEQRES records:

>d2rk9b_ d.32.1.0 (B:) automated matches {Vibrio splendidus [TaxId: 314291]}
tlrvvpelycfdinvsqsffvdvlgfevkyerpdeefvyltldgvdvmlegiagksrkwl
sgdlefplgsgvnfqwdvidieplyqrvnesaadsiylalesksyqcgdsiatqkqfmvq
tpdgylfrfcqdi

Sequence, based on observed residues (ATOM records):

>d2rk9b_ d.32.1.0 (B:) automated matches {Vibrio splendidus [TaxId: 314291]}
tlrvvpelycfdinvsqsffvdvlgfevkyerpdeefvyltldgvdvmleglefplgsgv
nfqwdvidieplyqrvnesaadsiylalesksyqiatqkqfmvqtpdgylfrfcqdi

Timeline for d2rk9b_:

• d2rk9b_ first appeared in SCOPe 2.02
  
• d2rk9b_ appears in SCOPe 2.07