![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.41: Subtilisin-like [52742] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3 |
![]() | Superfamily c.41.1: Subtilisin-like [52743] (3 families) ![]() |
![]() | Family c.41.1.0: automated matches [191390] (1 protein) not a true family |
![]() | Protein automated matches [190500] (7 species) not a true protein |
![]() | Species Prochloron didemni [TaxId:1216] [194745] (3 PDB entries) |
![]() | Domain d3zxxa_: 3zxx A: [194746] automated match to d1dbia_ |
PDB Entry: 3zxx (more details), 1.95 Å
SCOPe Domain Sequences for d3zxxa_:
Sequence, based on SEQRES records: (download)
>d3zxxa_ c.41.1.0 (A:) automated matches {Prochloron didemni [TaxId: 1216]} lkgdhnirvaildgpvdiahpcfqgadltvlptlaptaarsdgfmsahgthvasiifgqp etsvpgiapqcrglivpifsddrrritqldlargieravnagahiinisggeltdfgead gwlenavslcrqnnvllvaaagnngcdclhvpaalpavlavgamddhghpldfsnwgsty eqqgilapgedilgakpgggterlsgtsfatpivsgvaalllseqvrrgetpdpqkvrql llqsalpcdddapeqarrclagrlnvsgaftllkggnm
>d3zxxa_ c.41.1.0 (A:) automated matches {Prochloron didemni [TaxId: 1216]} lkgdhnirvaildgpvdiahpcfqgadltvlptlapgfmsahgthvasiifgqpetsvpg iapqcrglivpifsddrrritqldlargieravnagahiinisggeltdfgeadgwlena vslcrqnnvllvaaagnngcdclhvpaalpavlavgamddhghpldfsnwgstyeqqgil apgedilgakpgggterlsgtsfatpivsgvaalllseqvrrgetpdpqkvrqlllqsal pcarrclagrlnvsgaftllkggnm
Timeline for d3zxxa_: