Lineage for d3zxxa_ (3zxx A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114950Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2114951Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2115291Family c.41.1.0: automated matches [191390] (1 protein)
    not a true family
  6. 2115292Protein automated matches [190500] (8 species)
    not a true protein
  7. 2115308Species Prochloron didemni [TaxId:1216] [194745] (3 PDB entries)
  8. 2115311Domain d3zxxa_: 3zxx A: [194746]
    automated match to d1dbia_

Details for d3zxxa_

PDB Entry: 3zxx (more details), 1.95 Å

PDB Description: Structure of self-cleaved protease domain of PatA
PDB Compounds: (A:) subtilisin-like protein

SCOPe Domain Sequences for d3zxxa_:

Sequence, based on SEQRES records: (download)

>d3zxxa_ c.41.1.0 (A:) automated matches {Prochloron didemni [TaxId: 1216]}
lkgdhnirvaildgpvdiahpcfqgadltvlptlaptaarsdgfmsahgthvasiifgqp
etsvpgiapqcrglivpifsddrrritqldlargieravnagahiinisggeltdfgead
gwlenavslcrqnnvllvaaagnngcdclhvpaalpavlavgamddhghpldfsnwgsty
eqqgilapgedilgakpgggterlsgtsfatpivsgvaalllseqvrrgetpdpqkvrql
llqsalpcdddapeqarrclagrlnvsgaftllkggnm

Sequence, based on observed residues (ATOM records): (download)

>d3zxxa_ c.41.1.0 (A:) automated matches {Prochloron didemni [TaxId: 1216]}
lkgdhnirvaildgpvdiahpcfqgadltvlptlapgfmsahgthvasiifgqpetsvpg
iapqcrglivpifsddrrritqldlargieravnagahiinisggeltdfgeadgwlena
vslcrqnnvllvaaagnngcdclhvpaalpavlavgamddhghpldfsnwgstyeqqgil
apgedilgakpgggterlsgtsfatpivsgvaalllseqvrrgetpdpqkvrqlllqsal
pcarrclagrlnvsgaftllkggnm

SCOPe Domain Coordinates for d3zxxa_:

Click to download the PDB-style file with coordinates for d3zxxa_.
(The format of our PDB-style files is described here.)

Timeline for d3zxxa_: