Lineage for d4dwrc_ (4dwr C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1946662Fold d.261: Hypothetical protein PH1602 [103364] (1 superfamily)
    complex alpha+beta fold; contains a region of similarity to the ferredoxin-like fold
  4. 1946663Superfamily d.261.1: Hypothetical protein PH1602 [103365] (2 families) (S)
  5. 1946664Family d.261.1.1: Hypothetical protein PH1602 [103366] (2 proteins)
    automatically mapped to Pfam PF01139
  6. 1946677Protein automated matches [194738] (1 species)
    not a true protein
  7. 1946678Species Pyrococcus horikoshii [TaxId:53953] [194739] (1 PDB entry)
  8. 1946681Domain d4dwrc_: 4dwr C: [194740]
    automated match to d1uc2a_
    protein/RNA complex; complexed with mn, so4, suc

Details for d4dwrc_

PDB Entry: 4dwr (more details), 1.48 Å

PDB Description: rna ligase rtcb/mn2+ complex
PDB Compounds: (C:) tRNA-splicing ligase RtcB

SCOPe Domain Sequences for d4dwrc_:

Sequence, based on SEQRES records: (download)

>d4dwrc_ d.261.1.1 (C:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
vvplkridkirweipkfdkrmrvpgrvyadevllekmkndrtleqatnvamlpgiykysi
vmpdghqgygfpiggvaafdvkegvispggigydincgvrlirtnltekevrprikqlvd
tlfknvpsgvgsqgriklhwtqiddvlvdgakwavdngygwerdlerleeggrmegadpe
avsqrakqrgapqlgslgsgnhflevqvvdkifdpevakayglfegqvvvmvhtgsrglg
hqvasdylrimerairkyripwpdrelvsvpfqseegqryfsamkaaanfawanrqmith
wvresfqevfkqdpegdlgmdivydvahnigkveehevdgkrvkvivhrkgatrafppgh
eavprlyrdvgqpvlipgsmgtasyilagtegamketfgstchgagrvlsrkaatrqyrg
drirqellnrgiyvraasmrvvaeeapgayknvdnvvkvvseagiaklvarmrpigvakg
aaale

Sequence, based on observed residues (ATOM records): (download)

>d4dwrc_ d.261.1.1 (C:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
vvplkridkirweipkfdkrmrvpgrvyadevllekmkndrtleqatnvamlpgiykysi
vmpdghqgygfpiggvaafdvkegvispggigydincgvrlirtnltekevrprikqlvd
tlfknvpsgvriklhwtqiddvlvdgakwavdngygwerdlerleeggrmegadpeavsq
rakqrgapqlgslgsgnhflevqvvdkifdpevakayglfegqvvvmvhtgsrglghqva
sdylrimerairkyripwpdrelvsvpfqseegqryfsamkaaanfawanrqmithwvre
sfqevfkqdpegdlgmdivydvahnigkveehevdgkrvkvivhrkgatrafppgheavp
rlyrdvgqpvlipgsmgtasyilagtegamketfgstchgagrvlsrkaatrqyrgdrir
qellnrgiyvraasmrvvaeeapgayknvdnvvkvvseagiaklvarmrpigvakgaaal
e

SCOPe Domain Coordinates for d4dwrc_:

Click to download the PDB-style file with coordinates for d4dwrc_.
(The format of our PDB-style files is described here.)

Timeline for d4dwrc_: