Lineage for d1aonb1 (1aon B:2-136,B:410-525)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 51151Fold a.129: GroEL-like chaperones, ATPase domain [48591] (1 superfamily)
  4. 51152Superfamily a.129.1: GroEL-like chaperones, ATPase domain [48592] (2 families) (S)
  5. 51153Family a.129.1.1: GroEL [48593] (1 protein)
  6. 51154Protein GroEL [48594] (1 species)
  7. 51155Species Escherichia coli [TaxId:562] [48595] (4 PDB entries)
  8. 51178Domain d1aonb1: 1aon B:2-136,B:410-525 [19474]
    Other proteins in same PDB: d1aona2, d1aona3, d1aonb2, d1aonb3, d1aonc2, d1aonc3, d1aond2, d1aond3, d1aone2, d1aone3, d1aonf2, d1aonf3, d1aong2, d1aong3, d1aonh2, d1aonh3, d1aoni2, d1aoni3, d1aonj2, d1aonj3, d1aonk2, d1aonk3, d1aonl2, d1aonl3, d1aonm2, d1aonm3, d1aonn2, d1aonn3, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_

Details for d1aonb1

PDB Entry: 1aon (more details), 3 Å

PDB Description: crystal structure of the asymmetric chaperonin complex groel/groes/(adp)7

SCOP Domain Sequences for d1aonb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aonb1 a.129.1.1 (B:2-136,B:410-525) GroEL {Escherichia coli}
aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
kavtaaveelkalsvXgvvagggvalirvaskladlrgqnedqnvgikvalrameaplrq
ivlncgeepsvvantvkggdgnygynaateeygnmidmgildptkvtrsalqyaasvagl
mittecmvtdlp

SCOP Domain Coordinates for d1aonb1:

Click to download the PDB-style file with coordinates for d1aonb1.
(The format of our PDB-style files is described here.)

Timeline for d1aonb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1aona1, d1aona2, d1aona3, d1aonc1, d1aonc2, d1aonc3, d1aond1, d1aond2, d1aond3, d1aone1, d1aone2, d1aone3, d1aonf1, d1aonf2, d1aonf3, d1aong1, d1aong2, d1aong3, d1aonh1, d1aonh2, d1aonh3, d1aoni1, d1aoni2, d1aoni3, d1aonj1, d1aonj2, d1aonj3, d1aonk1, d1aonk2, d1aonk3, d1aonl1, d1aonl2, d1aonl3, d1aonm1, d1aonm2, d1aonm3, d1aonn1, d1aonn2, d1aonn3, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_