SCOPe 2.02: Domain d4f19a_: 4f19 A:

Lineage for d4f19a_ (4f19 A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)

6. Protein Phosphate-binding protein [53860] (4 species)

7. Species Pseudomonas fluorescens [TaxId:294] [189065] (4 PDB entries)

8. Domain d4f19a_: 4f19 A: [194735]
   automated match to d4f1ua_
   complexed with 8ar

Details for d4f19a_

PDB Entry: 4f19, 0.95 Å

PDB Description: Subatomic resolution structure of a high affinity periplasmic phosphate-binding protein (PfluDING) bound with arsenate at pH 4.5

PDB Compounds: (A:) Putative alkaline phosphatase

SCOPe Domain Sequences for d4f19a_:

Sequence; same for both SEQRES and ATOM records:

>d4f19a_ c.94.1.1 (A:) Phosphate-binding protein {Pseudomonas fluorescens [TaxId: 294]}
mdingggatlpqalyqtsgvltagfaqyigvgsgngkaaflnndytkfqagvtnknvhwa
gsdsklsatelstyasakqptwgkliqvpsvgtsvaipfnksgsaavdlsvqelcgvfsg
rintwdgisgsgrtgpivvvyrsessgttelftrflnakcnaetgnfavtttfgtsfsgg
lpagavaatgsqgvmtalaagdgritymspdfaaptlaglddatkvarvgknvatntqgv
spaaanvsaaigavpvpaaadrsnpdawvpvfgpdntagvqpyptsgypilgftnlifsq
cyadatqttqvrdfftkhygasnnndaaitanafvplptawkatvrasfltasnalsign
tnvcngigrplleaa

Timeline for d4f19a_:

• d4f19a_ is new in SCOPe 2.02-stable
  
• d4f19a_ appears in SCOPe 2.03
  
• d4f19a_ appears in the current release, SCOPe 2.08, called d4f19a1