SCOPe 2.08: Domain d4fmcd_: 4fmc D:

Lineage for d4fmcd_ (4fmc D:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab1a [142241] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142242] (3 PDB entries)
   Uniprot P62820 7-175

8. Domain d4fmcd_: 4fmc D: [194733]
   automated match to d2fola1
   complexed with af3, gdp, mg, pge

Details for d4fmcd_

PDB Entry: 4fmc, 2.8 Å

PDB Description: EspG-Rab1 complex

PDB Compounds: (D:) Ras-related protein Rab-1A

SCOPe Domain Sequences for d4fmcd_:

Sequence; same for both SEQRES and ATOM records:

>d4fmcd_ c.37.1.8 (D:) Rab1a {Human (Homo sapiens) [TaxId: 9606]}
peydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiw
dtagqerfrtitssyyrgahgiivvydvtdqesfnnvkqwlqeidryasenvnkllvgnk
cdlttkkvvdyttakefadslgipfletsaknatnveqsfmtmaaeikkrm

Timeline for d4fmcd_:

• d4fmcd_ first appeared in SCOPe 2.02
  
• d4fmcd_ appears in SCOPe 2.07