SCOPe 2.05: Domain d4fwba_: 4fwb A:

Lineage for d4fwba_ (4fwb A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)

6. Protein automated matches [190880] (4 species)
   not a true protein

7. Species Rhodococcus rhodochrous [TaxId:1829] [189127] (9 PDB entries)

8. Domain d4fwba_: 4fwb A: [194732]
   automated match to d3fwha_
   complexed with 3kp, cl; mutant

Details for d4fwba_

PDB Entry: 4fwb, 1.26 Å

PDB Description: structure of rhodococcus rhodochrous haloalkane dehalogenase mutant dhaa31 in complex with 1, 2, 3 - trichloropropane

PDB Compounds: (A:) haloalkane dehalogenase

SCOPe Domain Sequences for d4fwba_:

Sequence; same for both SEQRES and ATOM records:

>d4fwba_ c.69.1.8 (A:) automated matches {Rhodococcus rhodochrous [TaxId: 1829]}
igtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssylwrniiphvapshrcia
pdligmgksdkpdldyffddhvryldafiealgleevvlvihdwgsalgfhwakrnperv
kgiacmefirpfptwdewpefaretfqafrtadvgreliidqnafiegalpkyvvrplte
vemdhyrepflkpvdreplwrfpnelpiagepanivalveaymnwlhqspvpkllfwgtp
gfiippaeaarlaeslpncktvdigpglhflqednpdligseiarwlpalhh

Timeline for d4fwba_:

• d4fwba_ first appeared in SCOPe 2.02
  
• d4fwba_ appears in SCOPe 2.04
  
• d4fwba_ is called d4fwba1 in SCOPe 2.06
  
• d4fwba_ appears in the current release, SCOPe 2.08, called d4fwba1