Lineage for d4fwba1 (4fwb A:4-293)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900279Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)
  6. 2900319Protein automated matches [190880] (5 species)
    not a true protein
  7. 2900325Species Rhodococcus rhodochrous [TaxId:1829] [189127] (16 PDB entries)
  8. 2900332Domain d4fwba1: 4fwb A:4-293 [194732]
    Other proteins in same PDB: d4fwba2
    automated match to d3fwha_
    complexed with 3kp, cl; mutant

Details for d4fwba1

PDB Entry: 4fwb (more details), 1.26 Å

PDB Description: structure of rhodococcus rhodochrous haloalkane dehalogenase mutant dhaa31 in complex with 1, 2, 3 - trichloropropane
PDB Compounds: (A:) haloalkane dehalogenase

SCOPe Domain Sequences for d4fwba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fwba1 c.69.1.8 (A:4-293) automated matches {Rhodococcus rhodochrous [TaxId: 1829]}
igtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssylwrniiphvapshrcia
pdligmgksdkpdldyffddhvryldafiealgleevvlvihdwgsalgfhwakrnperv
kgiacmefirpfptwdewpefaretfqafrtadvgreliidqnafiegalpkyvvrplte
vemdhyrepflkpvdreplwrfpnelpiagepanivalveaymnwlhqspvpkllfwgtp
gfiippaeaarlaeslpncktvdigpglhflqednpdligseiarwlpal

SCOPe Domain Coordinates for d4fwba1:

Click to download the PDB-style file with coordinates for d4fwba1.
(The format of our PDB-style files is described here.)

Timeline for d4fwba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4fwba2