Lineage for d3tm6a1 (3tm6 A:1-98)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2745638Protein beta2-microglobulin [88600] (7 species)
  7. 2745653Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries)
    Uniprot P61769 21-119 ! Uniprot P01884
  8. 2746170Domain d3tm6a1: 3tm6 A:1-98 [194722]
    Other proteins in same PDB: d3tm6a2, d3tm6b2, d3tm6c2, d3tm6d2, d3tm6e2, d3tm6f2, d3tm6g2, d3tm6h2
    automated match to d1k5nb_
    complexed with peg, po4; mutant

Details for d3tm6a1

PDB Entry: 3tm6 (more details), 2.7 Å

PDB Description: Crystal structure of the beta-2 microglobulin DIMC50 disulphide-linked homodimer mutant
PDB Compounds: (A:) Beta-2-microglobulin

SCOPe Domain Sequences for d3tm6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tm6a1 b.1.1.2 (A:1-98) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]}
iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvchsdlsfskdw
sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrd

SCOPe Domain Coordinates for d3tm6a1:

Click to download the PDB-style file with coordinates for d3tm6a1.
(The format of our PDB-style files is described here.)

Timeline for d3tm6a1: