SCOPe 2.05: Domain d2ywda_: 2ywd A:

Lineage for d2ywda_ (2ywd A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
   contains a catalytic Cys-His-Glu triad

6. Protein Hypothetical protein YaaE [102250] (4 species)
   glutamine amidotransferase of SNO/PDX2 family implicated in pyridoxine biosynthesis

7. Species Thermus thermophilus HB8 [TaxId:300852] [194720] (1 PDB entry)

8. Domain d2ywda_: 2ywd A: [194721]
   automated match to d2isse_

Details for d2ywda_

PDB Entry: 2ywd, 1.9 Å

PDB Description: Crystal structure of glutamine amidotransferase

PDB Compounds: (A:) Glutamine amidotransferase subunit pdxT

SCOPe Domain Sequences for d2ywda_:

Sequence; same for both SEQRES and ATOM records:

>d2ywda_ c.23.16.1 (A:) Hypothetical protein YaaE {Thermus thermophilus HB8 [TaxId: 300852]}
gvvgvlalqgdfrehkealkrlgieakevrkkehleglkalivpggesttigklareygi
edevrkrveegslalfgtcagaiwlakeivgypeqprlgvleawvernafgrqvesfeed
leveglgsfhgvfirapvfrrlgegvevlarlgdlpvlvrqgkvlassfhpeltedprlh
ryflelagv

Timeline for d2ywda_:

• d2ywda_ first appeared in SCOPe 2.02
  
• d2ywda_ appears in SCOPe 2.04
  
• d2ywda_ appears in SCOPe 2.06
  
• d2ywda_ appears in the current release, SCOPe 2.08