Lineage for d3tn2a_ (3tn2 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1193305Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 1193306Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 1193307Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 1193566Protein automated matches [190403] (2 species)
    not a true protein
  7. 1193567Species Human (Homo sapiens) [TaxId:9606] [187277] (9 PDB entries)
  8. 1193568Domain d3tn2a_: 3tn2 A: [194719]
    automated match to d1huna_
    complexed with zn

Details for d3tn2a_

PDB Entry: 3tn2 (more details), 1.6 Å

PDB Description: structure analysis of mip1-beta p8a
PDB Compounds: (A:) c-c motif chemokine 4

SCOPe Domain Sequences for d3tn2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tn2a_ d.9.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apmgsdpataccfsytarklprnfvvdyyetsslcsqpavvfqtkrskqvcadpseswvq
eyvydlel

SCOPe Domain Coordinates for d3tn2a_:

Click to download the PDB-style file with coordinates for d3tn2a_.
(The format of our PDB-style files is described here.)

Timeline for d3tn2a_: