| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) ![]() form dimers with different dimerisation modes |
| Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) |
| Protein Macrophage inflammatory protein, MIP [54128] (5 species) has different dimerisation mode |
| Species Human (Homo sapiens), 1-beta [TaxId:9606] [54129] (7 PDB entries) |
| Domain d3tn2a_: 3tn2 A: [194719] automated match to d1huna_ complexed with zn |
PDB Entry: 3tn2 (more details), 1.6 Å
SCOPe Domain Sequences for d3tn2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tn2a_ d.9.1.1 (A:) Macrophage inflammatory protein, MIP {Human (Homo sapiens), 1-beta [TaxId: 9606]}
apmgsdpataccfsytarklprnfvvdyyetsslcsqpavvfqtkrskqvcadpseswvq
eyvydlel
Timeline for d3tn2a_: