| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families) ![]() |
| Family d.58.10.1: Acylphosphatase-like [54976] (4 proteins) |
| Protein automated matches [191024] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188822] (4 PDB entries) |
| Domain d3toqa_: 3toq A: [194718] automated match to d2w4pa_ complexed with po4 |
PDB Entry: 3toq (more details), 2 Å
SCOPe Domain Sequences for d3toqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3toqa_ d.58.10.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ntlisadleifgkvqgvffrkhmqaeakklgvvgwvqntdrgtvqaqlqgpiskvrhlqe
waetrgspkshidkanfnnekvilkldysdfqivk
Timeline for d3toqa_: