Lineage for d3toqa_ (3toq A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1206080Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families) (S)
  5. 1206081Family d.58.10.1: Acylphosphatase-like [54976] (4 proteins)
  6. 1206101Protein automated matches [191024] (3 species)
    not a true protein
  7. 1206102Species Human (Homo sapiens) [TaxId:9606] [188822] (4 PDB entries)
  8. 1206106Domain d3toqa_: 3toq A: [194718]
    automated match to d2w4pa_
    complexed with po4

Details for d3toqa_

PDB Entry: 3toq (more details), 2 Å

PDB Description: Acylphosphatase with mesophilic surface and thermophilic core
PDB Compounds: (A:) acylphosphatase-1

SCOPe Domain Sequences for d3toqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3toqa_ d.58.10.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ntlisadleifgkvqgvffrkhmqaeakklgvvgwvqntdrgtvqaqlqgpiskvrhlqe
waetrgspkshidkanfnnekvilkldysdfqivk

SCOPe Domain Coordinates for d3toqa_:

Click to download the PDB-style file with coordinates for d3toqa_.
(The format of our PDB-style files is described here.)

Timeline for d3toqa_: