Lineage for d4b9fb_ (4b9f B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2040342Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2040356Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
    Pfam PF00963
  6. 2040379Protein Cellusomal scaffolding protein A, scaffoldin [49391] (3 species)
  7. 2040385Species Clostridium thermocellum [TaxId:203119] [194716] (1 PDB entry)
  8. 2040387Domain d4b9fb_: 4b9f B: [194717]
    automated match to d1nbca_
    complexed with ca, so4

Details for d4b9fb_

PDB Entry: 4b9f (more details), 1.19 Å

PDB Description: High resolution structure for family 3a carbohydrate binding module from the cipA scaffolding of clostridium thermocellum
PDB Compounds: (B:) Cellulosomal-scaffolding protein A

SCOPe Domain Sequences for d4b9fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b9fb_ b.2.2.2 (B:) Cellusomal scaffolding protein A, scaffoldin {Clostridium thermocellum [TaxId: 203119]}
nlkvefynsnpsdttnsinpqfkvtntgssaidlskltlryyytvdgqkdqtfwcdhaai
igsngsyngitsnvkgtfvkmssstnnadtyleisftggtlepgahvqiqgrfakndwsn
ytqsndysfksasqfvewdqvtaylngvlvwg

SCOPe Domain Coordinates for d4b9fb_:

Click to download the PDB-style file with coordinates for d4b9fb_.
(The format of our PDB-style files is described here.)

Timeline for d4b9fb_: