Lineage for d4g41a_ (4g41 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1173024Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1173040Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 1173695Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 1173696Protein automated matches [190781] (9 species)
    not a true protein
  7. 1173763Species Streptococcus pyogenes [TaxId:864568] [194708] (1 PDB entry)
  8. 1173764Domain d4g41a_: 4g41 A: [194710]
    automated match to d1zosa_
    complexed with mta

Details for d4g41a_

PDB Entry: 4g41 (more details), 1.45 Å

PDB Description: Crystal structure of s-adenosylhomocysteine nucleosidase from streptococcus pyogenes in complex with 5-methylthiotubericidin
PDB Compounds: (A:) MTA/SAH nucleosidase

SCOPe Domain Sequences for d4g41a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g41a_ c.56.2.0 (A:) automated matches {Streptococcus pyogenes [TaxId: 864568]}
gamgsmkigiiaameeelslllanlldaqehqvlsktyytgrfgkhelilvqsgvgkvms
amtvailvehfkaqaiintgsagavashlaigdvvvadrlvyhdvdatafgyaygqmagq
plyydcdpqfvaifkqvlkhektngqvgliatgdsfvagqdkidqiktafsnvlavemeg
aaiaqaahtagkpfivvramsdtaahdanitfdqfiieagkrsaqilmtflenlpv

SCOPe Domain Coordinates for d4g41a_:

Click to download the PDB-style file with coordinates for d4g41a_.
(The format of our PDB-style files is described here.)

Timeline for d4g41a_: