| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) ![]() complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
| Family c.56.2.0: automated matches [191488] (1 protein) not a true family |
| Protein automated matches [190781] (46 species) not a true protein |
| Species Streptococcus pyogenes [TaxId:864568] [194708] (1 PDB entry) |
| Domain d4g41a1: 4g41 A:1-231 [194710] Other proteins in same PDB: d4g41a2, d4g41b2 automated match to d1zosa_ complexed with mta |
PDB Entry: 4g41 (more details), 1.45 Å
SCOPe Domain Sequences for d4g41a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g41a1 c.56.2.0 (A:1-231) automated matches {Streptococcus pyogenes [TaxId: 864568]}
mkigiiaameeelslllanlldaqehqvlsktyytgrfgkhelilvqsgvgkvmsamtva
ilvehfkaqaiintgsagavashlaigdvvvadrlvyhdvdatafgyaygqmagqplyyd
cdpqfvaifkqvlkhektngqvgliatgdsfvagqdkidqiktafsnvlavemegaaiaq
aahtagkpfivvramsdtaahdanitfdqfiieagkrsaqilmtflenlpv
Timeline for d4g41a1: