SCOPe 2.08: Domain d4g41a1: 4g41 A:1-231

Lineage for d4g41a1 (4g41 A:1-231)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (46 species)
   not a true protein

7. Species Streptococcus pyogenes [TaxId:864568] [194708] (1 PDB entry)

8. Domain d4g41a1: 4g41 A:1-231 [194710]
   Other proteins in same PDB: d4g41a2, d4g41b2
   automated match to d1zosa_
   complexed with mta

Details for d4g41a1

PDB Entry: 4g41, 1.45 Å

PDB Description: Crystal structure of s-adenosylhomocysteine nucleosidase from streptococcus pyogenes in complex with 5-methylthiotubericidin

PDB Compounds: (A:) MTA/SAH nucleosidase

SCOPe Domain Sequences for d4g41a1:

Sequence; same for both SEQRES and ATOM records:

>d4g41a1 c.56.2.0 (A:1-231) automated matches {Streptococcus pyogenes [TaxId: 864568]}
mkigiiaameeelslllanlldaqehqvlsktyytgrfgkhelilvqsgvgkvmsamtva
ilvehfkaqaiintgsagavashlaigdvvvadrlvyhdvdatafgyaygqmagqplyyd
cdpqfvaifkqvlkhektngqvgliatgdsfvagqdkidqiktafsnvlavemegaaiaq
aahtagkpfivvramsdtaahdanitfdqfiieagkrsaqilmtflenlpv

Timeline for d4g41a1:

• d4g41a1 first appeared in SCOPe 2.02, called d4g41a_
  
• d4g41a1 appears in SCOPe 2.07