Lineage for d4g41b1 (4g41 B:1-231)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2888846Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2888847Protein automated matches [190781] (46 species)
    not a true protein
  7. 2889234Species Streptococcus pyogenes [TaxId:864568] [194708] (1 PDB entry)
  8. 2889236Domain d4g41b1: 4g41 B:1-231 [194709]
    Other proteins in same PDB: d4g41a2, d4g41b2
    automated match to d1zosa_
    complexed with mta

Details for d4g41b1

PDB Entry: 4g41 (more details), 1.45 Å

PDB Description: Crystal structure of s-adenosylhomocysteine nucleosidase from streptococcus pyogenes in complex with 5-methylthiotubericidin
PDB Compounds: (B:) MTA/SAH nucleosidase

SCOPe Domain Sequences for d4g41b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g41b1 c.56.2.0 (B:1-231) automated matches {Streptococcus pyogenes [TaxId: 864568]}
mkigiiaameeelslllanlldaqehqvlsktyytgrfgkhelilvqsgvgkvmsamtva
ilvehfkaqaiintgsagavashlaigdvvvadrlvyhdvdatafgyaygqmagqplyyd
cdpqfvaifkqvlkhektngqvgliatgdsfvagqdkidqiktafsnvlavemegaaiaq
aahtagkpfivvramsdtaahdanitfdqfiieagkrsaqilmtflenlpv

SCOPe Domain Coordinates for d4g41b1:

Click to download the PDB-style file with coordinates for d4g41b1.
(The format of our PDB-style files is described here.)

Timeline for d4g41b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4g41b2