SCOPe 2.02: Domain d4grdb_: 4grd B:

Lineage for d4grdb_ (4grd B:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families)

5. Family c.23.8.0: automated matches [191522] (1 protein)
   not a true family

6. Protein automated matches [190879] (4 species)
   not a true protein

7. Species Burkholderia cenocepacia [TaxId:216591] [193525] (1 PDB entry)

8. Domain d4grdb_: 4grd B: [194707]
   automated match to d3oowg_

Details for d4grdb_

PDB Entry: 4grd, 1.85 Å

PDB Description: crystal structure of phosphoribosylaminoimidazole carboxylase catalytic subunit from burkholderia cenocepacia j2315

PDB Compounds: (B:) Phosphoribosylaminoimidazole carboxylase catalytic subunit

SCOPe Domain Sequences for d4grdb_:

Sequence; same for both SEQRES and ATOM records:

>d4grdb_ c.23.8.0 (B:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
tahthsaplvgvlmgsssdwdvmkhavailqefgvpyeakvvsahrmpdemfdyaekare
rglraiiagaggaahlpgmlaakttvpvlgvpvaskylkgvdslhsivqmpkgvpvatfa
igeagaanaalfavsilsgnsvdyanrlaafrvrqneaahamvlpple

Timeline for d4grdb_:

• d4grdb_ is new in SCOPe 2.02-stable
  
• d4grdb_ appears in SCOPe 2.03
  
• d4grdb_ appears in the current release, SCOPe 2.08