| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
| Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
| Protein MAP kinase Erk2 [56134] (2 species) CMGC group; ERK/MAPK subfamily; serine/threonine kinase |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [56136] (58 PDB entries) |
| Domain d4gt3a_: 4gt3 A: [194704] automated match to d1erka_ complexed with atp, gol, mg, peg |
PDB Entry: 4gt3 (more details), 1.68 Å
SCOPe Domain Sequences for d4gt3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gt3a_ d.144.1.7 (A:) MAP kinase Erk2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqtycqrtlr
eikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyfl
yqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyvat
rwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqe
dlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalah
pyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgy
Timeline for d4gt3a_: