Lineage for d3u4xa_ (3u4x A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042739Protein automated matches [190035] (27 species)
    not a true protein
  7. 2042790Species Camptosema pedicellatum [TaxId:232302] [194699] (1 PDB entry)
  8. 2042791Domain d3u4xa_: 3u4x A: [194700]
    automated match to d2d3pa_
    complexed with ca, mn, xmm

Details for d3u4xa_

PDB Entry: 3u4x (more details), 2.16 Å

PDB Description: Crystal structure of a lectin from Camptosema pedicellatum seeds in complex with 5-bromo-4-chloro-3-indolyl-alpha-D-mannose
PDB Compounds: (A:) Camptosema pedicellatum lectin (CPL)

SCOPe Domain Sequences for d3u4xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u4xa_ b.29.1.1 (A:) automated matches {Camptosema pedicellatum [TaxId: 232302]}
adtivaveldtypntdigdpnyqhiginiksirskattrwnvqdgkvgtahisynsvakr
lsaivsypggssatvsydvdlnnilpewvrvglsastgvyketntilswsftsklktnst
adaqslhftfnqfsqspkdlilqgdastdsdgnlqltrvsngspqsnsvgralyyapvhv
wdksavvasfdatftflikspdsdpadgiaffiantdssiphgsggrllglfpdan

SCOPe Domain Coordinates for d3u4xa_:

Click to download the PDB-style file with coordinates for d3u4xa_.
(The format of our PDB-style files is described here.)

Timeline for d3u4xa_: