Lineage for d3vkoa_ (3vko A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1118105Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1118106Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1119701Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1119702Protein automated matches [190437] (13 species)
    not a true protein
  7. 1119732Species Human (Homo sapiens) [TaxId:9606] [187655] (25 PDB entries)
  8. 1119767Domain d3vkoa_: 3vko A: [194695]
    automated match to d3ap5a_
    complexed with cl

Details for d3vkoa_

PDB Entry: 3vko (more details), 2.08 Å

PDB Description: galectin-8 n-terminal domain in complex with sialyllactosamine
PDB Compounds: (A:) Galectin-8

SCOPe Domain Sequences for d3vkoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vkoa_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssmkpradvafhf
nprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtlly
ghrigpekidtlgiygkvnihsigfsf

SCOPe Domain Coordinates for d3vkoa_:

Click to download the PDB-style file with coordinates for d3vkoa_.
(The format of our PDB-style files is described here.)

Timeline for d3vkoa_: