SCOPe 2.02: Domain d3vkoa_: 3vko A:

Lineage for d3vkoa_ (3vko A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187655] (25 PDB entries)

8. Domain d3vkoa_: 3vko A: [194695]
   automated match to d3ap5a_
   complexed with cl

Details for d3vkoa_

PDB Entry: 3vko, 2.08 Å

PDB Description: galectin-8 n-terminal domain in complex with sialyllactosamine

PDB Compounds: (A:) Galectin-8

SCOPe Domain Sequences for d3vkoa_:

Sequence; same for both SEQRES and ATOM records:

>d3vkoa_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssmkpradvafhf
nprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtlly
ghrigpekidtlgiygkvnihsigfsf

Timeline for d3vkoa_:

• d3vkoa_ is new in SCOPe 2.02-stable
  
• d3vkoa_ appears in SCOPe 2.03
  
• d3vkoa_ appears in the current release, SCOPe 2.08