SCOPe 2.06: Domain d3vrca_: 3vrc A:

Lineage for d3vrca_ (3vrc A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)
   automatically mapped to Pfam PF01322

6. Protein automated matches [190363] (5 species)
   not a true protein

7. Species Thermochromatium tepidum [TaxId:1050] [194692] (1 PDB entry)

8. Domain d3vrca_: 3vrc A: [194694]
   automated match to d1bbha_
   complexed with cd, cl, hec, peg, pg4

Details for d3vrca_

PDB Entry: 3vrc, 1 Å

PDB Description: crystal structure of cytochrome c' from thermochromatium tepidum

PDB Compounds: (A:) cytochrome c'

SCOPe Domain Sequences for d3vrca_:

Sequence; same for both SEQRES and ATOM records:

>d3vrca_ a.24.3.2 (A:) automated matches {Thermochromatium tepidum [TaxId: 1050]}
dlspeeqietrqagyafmawnmgkikanlegeynadqvraaanvvaaiansgmgalygpg
tdknvgavktrakpelfqnledvgklardlgtaanalaaaaatgeanavksafadvgaac
kachqkyrad

Timeline for d3vrca_:

• d3vrca_ first appeared in SCOPe 2.02
  
• d3vrca_ appears in SCOPe 2.05
  
• d3vrca_ appears in SCOPe 2.07
  
• d3vrca_ appears in the current release, SCOPe 2.08