SCOPe 2.05: Domain d4b4na_: 4b4n A:

Lineage for d4b4na_ (4b4n A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein automated matches [190369] (6 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [187207] (7 PDB entries)

8. Domain d4b4na_: 4b4n A: [194691]
   automated match to d1afva_
   protein/RNA complex

Details for d4b4na_

PDB Entry: 4b4n, 1.81 Å

PDB Description: cpsf6 defines a conserved capsid interface that modulates hiv-1 replication

PDB Compounds: (A:) gag protein

SCOPe Domain Sequences for d4b4na_:

Sequence, based on SEQRES records:

>d4b4na_ a.73.1.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmys

Sequence, based on observed residues (ATOM records):

>d4b4na_ a.73.1.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvreprgsdiagttstlqeqigwmthnppipvgeiy
krwiilglnkivrmys

Timeline for d4b4na_:

• d4b4na_ first appeared in SCOPe 2.02
  
• d4b4na_ appears in SCOPe 2.04
  
• d4b4na_ appears in SCOPe 2.06
  
• d4b4na_ appears in the current release, SCOPe 2.08