Lineage for d4b4na_ (4b4n A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717816Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2717817Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2717818Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2718011Protein automated matches [190369] (8 species)
    not a true protein
  7. 2718012Species Human immunodeficiency virus 1 [TaxId:11676] [187207] (7 PDB entries)
  8. 2718016Domain d4b4na_: 4b4n A: [194691]
    automated match to d1afva_
    protein/RNA complex

Details for d4b4na_

PDB Entry: 4b4n (more details), 1.81 Å

PDB Description: cpsf6 defines a conserved capsid interface that modulates hiv-1 replication
PDB Compounds: (A:) gag protein

SCOPe Domain Sequences for d4b4na_:

Sequence, based on SEQRES records: (download)

>d4b4na_ a.73.1.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmys

Sequence, based on observed residues (ATOM records): (download)

>d4b4na_ a.73.1.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvreprgsdiagttstlqeqigwmthnppipvgeiy
krwiilglnkivrmys

SCOPe Domain Coordinates for d4b4na_:

Click to download the PDB-style file with coordinates for d4b4na_.
(The format of our PDB-style files is described here.)

Timeline for d4b4na_: