Lineage for d4fzwc_ (4fzw C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (54 species)
    not a true protein
  7. 2100099Species Escherichia coli K-12 [TaxId:83333] [194688] (5 PDB entries)
  8. 2100132Domain d4fzwc_: 4fzw C: [194689]
    Other proteins in same PDB: d4fzwb2
    automated match to d2ej5a_
    complexed with gol

Details for d4fzwc_

PDB Entry: 4fzw (more details), 2.55 Å

PDB Description: crystal structure of the paaf-paag hydratase-isomerase complex from e.coli
PDB Compounds: (C:) 1,2-epoxyphenylacetyl-CoA isomerase

SCOPe Domain Sequences for d4fzwc_:

Sequence, based on SEQRES records: (download)

>d4fzwc_ c.14.1.0 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
filshvekgvmtltlnrperlnsfndemhaqlaeclkqverddtircllltgagrgfcag
qdlndrnvdptgpapdlgmsverfynplvrrlaklpkpvicavngvaagagatlalggdi
viaarsakfvmafsklglipdcggtwllprvagraramglallgnqlsaeqahewgmiwq
vvddetladtaqqlarhlatqptfglglikqainsaetntldtqldlerdyqrlagrsad
yregvsaflakrspqftgk

Sequence, based on observed residues (ATOM records): (download)

>d4fzwc_ c.14.1.0 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
filshvekgvmtltlnrperlnsfndemhaqlaeclkqverddtircllltgagrgfcag
qdlnapdlgmsverfynplvrrlaklpkpvicavngvaagagatlalggdiviaarsakf
vmafsklglipdcggtwllprvagraramglallgnqlsaeqahewgmiwqvvddetlad
taqqlarhlatqptfglglikqainsaetntldtqldlerdyqrlagrsadyregvsafl
arspqftgk

SCOPe Domain Coordinates for d4fzwc_:

Click to download the PDB-style file with coordinates for d4fzwc_.
(The format of our PDB-style files is described here.)

Timeline for d4fzwc_: