SCOPe 2.06: Domain d2q73d_: 2q73 D:

Lineage for d2q73d_ (2q73 D:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
   multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer

4. Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families)
   basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat

5. Family a.204.1.0: automated matches [191410] (1 protein)
   not a true family

6. Protein automated matches [190562] (4 species)
   not a true protein

7. Species Vibrio sp. [TaxId:344879] [188224] (3 PDB entries)

8. Domain d2q73d_: 2q73 D: [194680]
   automated match to d2q5zb_
   complexed with mg

Details for d2q73d_

PDB Entry: 2q73, 1.8 Å

PDB Description: Crystal structure of iMazG from Vibrio DAT 722: Ctag-iMazG (P41212)

PDB Compounds: (D:) hypothetical protein

SCOPe Domain Sequences for d2q73d_:

Sequence; same for both SEQRES and ATOM records:

>d2q73d_ a.204.1.0 (D:) automated matches {Vibrio sp. [TaxId: 344879]}
fdyapeqsehyffklieevgelsesirkgksgqptldelkgsvaeelydvlyyvcalani
hgvnlekthelkevlnkvk

Timeline for d2q73d_:

• d2q73d_ first appeared in SCOPe 2.02
  
• d2q73d_ appears in SCOPe 2.05
  
• d2q73d_ appears in SCOPe 2.07
  
• d2q73d_ appears in the current release, SCOPe 2.08