Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
Protein automated matches [190061] (6 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187495] (5 PDB entries) |
Domain d3tsra_: 3tsr A: [194678] Other proteins in same PDB: d3tsre_, d3tsrf_, d3tsrg_, d3tsrh_ automated match to d1rraa_ complexed with edo, peg |
PDB Entry: 3tsr (more details), 2.2 Å
SCOPe Domain Sequences for d3tsra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tsra_ d.5.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} resaaqkfqrqhmdpdgssinsptycnqmmkrrdmtngsckpvntfvhepladvqavcsq envtcknrksncyksssalhitdchlkgnskypncdykttqyqkhiivacegnpyvpvhf datv
Timeline for d3tsra_: