Lineage for d3tsra_ (3tsr A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928015Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2928016Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2928017Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2928489Protein automated matches [190061] (7 species)
    not a true protein
  7. 2928627Species Mouse (Mus musculus) [TaxId:10090] [187495] (5 PDB entries)
  8. 2928633Domain d3tsra_: 3tsr A: [194678]
    Other proteins in same PDB: d3tsre1, d3tsre2, d3tsrf1, d3tsrf2, d3tsrg1, d3tsrg2, d3tsrh1, d3tsrh2
    automated match to d1rraa_
    complexed with edo, peg

Details for d3tsra_

PDB Entry: 3tsr (more details), 2.2 Å

PDB Description: x-ray structure of mouse ribonuclease inhibitor complexed with mouse ribonuclease 1
PDB Compounds: (A:) ribonuclease pancreatic

SCOPe Domain Sequences for d3tsra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tsra_ d.5.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
resaaqkfqrqhmdpdgssinsptycnqmmkrrdmtngsckpvntfvhepladvqavcsq
envtcknrksncyksssalhitdchlkgnskypncdykttqyqkhiivacegnpyvpvhf
datv

SCOPe Domain Coordinates for d3tsra_:

Click to download the PDB-style file with coordinates for d3tsra_.
(The format of our PDB-style files is described here.)

Timeline for d3tsra_: