![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
![]() | Superfamily d.5.1: RNase A-like [54076] (2 families) ![]() can be classified as disulfide-rich |
![]() | Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
![]() | Protein automated matches [190061] (7 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [187495] (5 PDB entries) |
![]() | Domain d3tsra_: 3tsr A: [194678] Other proteins in same PDB: d3tsre1, d3tsre2, d3tsrf1, d3tsrf2, d3tsrg1, d3tsrg2, d3tsrh1, d3tsrh2 automated match to d1rraa_ complexed with edo, peg |
PDB Entry: 3tsr (more details), 2.2 Å
SCOPe Domain Sequences for d3tsra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tsra_ d.5.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} resaaqkfqrqhmdpdgssinsptycnqmmkrrdmtngsckpvntfvhepladvqavcsq envtcknrksncyksssalhitdchlkgnskypncdykttqyqkhiivacegnpyvpvhf datv
Timeline for d3tsra_: