Lineage for d3tuhb_ (3tuh B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1217156Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1217157Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 1217158Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 1217159Protein HSP90 [55876] (3 species)
  7. 1217228Species Human (Homo sapiens) [TaxId:9606] [55878] (60 PDB entries)
    Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223
  8. 1217254Domain d3tuhb_: 3tuh B: [194676]
    automated match to d3r4pb_
    complexed with tuh

Details for d3tuhb_

PDB Entry: 3tuh (more details), 1.8 Å

PDB Description: crystal structure of the n-terminal domain of an hsp90 in the presence of an the inhibitor ganetespib
PDB Compounds: (B:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d3tuhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tuhb_ d.122.1.1 (B:) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel
hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv
gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte
yleerrikeivkkhsqfigypitlfvek

SCOPe Domain Coordinates for d3tuhb_:

Click to download the PDB-style file with coordinates for d3tuhb_.
(The format of our PDB-style files is described here.)

Timeline for d3tuhb_: