SCOPe 2.08: Domain d3tuhb_: 3tuh B:

Lineage for d3tuhb_ (3tuh B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein HSP90 [55876] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55878] (189 PDB entries)
   Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223

8. Domain d3tuhb_: 3tuh B: [194676]
   automated match to d3r4pb_
   complexed with tuh

Details for d3tuhb_

PDB Entry: 3tuh, 1.8 Å

PDB Description: crystal structure of the n-terminal domain of an hsp90 in the presence of an the inhibitor ganetespib

PDB Compounds: (B:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d3tuhb_:

Sequence; same for both SEQRES and ATOM records:

>d3tuhb_ d.122.1.1 (B:) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel
hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv
gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte
yleerrikeivkkhsqfigypitlfvek

Timeline for d3tuhb_:

• d3tuhb_ first appeared in SCOPe 2.02
  
• d3tuhb_ appears in SCOPe 2.07