Lineage for d3vk3d_ (3vk3 D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131439Family c.67.1.3: Cystathionine synthase-like [53402] (17 protein domains)
  6. 2131631Protein automated matches [190399] (9 species)
    not a true protein
  7. 2131666Species Pseudomonas putida [TaxId:303] [187269] (4 PDB entries)
  8. 2131674Domain d3vk3d_: 3vk3 D: [194674]
    automated match to d1ukja_
    complexed with met; mutant

Details for d3vk3d_

PDB Entry: 3vk3 (more details), 2.1 Å

PDB Description: Crystal Structure of L-Methionine gamma-Lyase from Pseudomonas putida C116H Mutant Complexed with L-methionine
PDB Compounds: (D:) methionine gamma-lyase

SCOPe Domain Sequences for d3vk3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vk3d_ c.67.1.3 (D:) automated matches {Pseudomonas putida [TaxId: 303]}
lpgfatraihhgydpqdhggalvppvyqtatftfptveygaacfageqaghfysrisnpt
lnllearmasleggeaglalasgmgaitstlwtllrpgdevllgntlyghtfaflhhgig
efgvklrhvdmadlqaleaamtpatrviyfespanpnmhmadiagvakiarkhgatvvvd
ntyctpylqrplelgadlvvhsatkylsghgditagivvgsqalvdrirlqglkdmtgav
lsphdaallmrgiktlnlrmdrhcanaqvlaeflarqpqvelihypglasfpqytlarqq
msqpggmiafelkggigagrrfmnalqlfsravslgdaeslaqhpasmthssytpeerah
ygiseglvrlsvglediddlladvqqalkasa

SCOPe Domain Coordinates for d3vk3d_:

Click to download the PDB-style file with coordinates for d3vk3d_.
(The format of our PDB-style files is described here.)

Timeline for d3vk3d_: