Lineage for d3vk2c_ (3vk2 C:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1176924Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1176925Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1177348Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 1177533Protein automated matches [190399] (4 species)
    not a true protein
  7. 1177543Species Pseudomonas putida [TaxId:303] [187269] (4 PDB entries)
  8. 1177554Domain d3vk2c_: 3vk2 C: [194668]
    automated match to d1ukja_
    complexed with so4; mutant

Details for d3vk2c_

PDB Entry: 3vk2 (more details), 2.3 Å

PDB Description: crystal structure of l-methionine gamma-lyase from pseudomonas putida c116h mutant.
PDB Compounds: (C:) methionine gamma-lyase

SCOPe Domain Sequences for d3vk2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vk2c_ c.67.1.3 (C:) automated matches {Pseudomonas putida [TaxId: 303]}
lpgfatraihhgydpqdhggalvppvyqtatftfptveygaacfageqaghfysrisnpt
lnllearmasleggeaglalasgmgaitstlwtllrpgdevllgntlyghtfaflhhgig
efgvklrhvdmadlqaleaamtpatrviyfespanpnmhmadiagvakiarkhgatvvvd
ntyctpylqrplelgadlvvhsatkylsghgditagivvgsqalvdrirlqglkdmtgav
lsphdaallmrgiktlnlrmdrhcanaqvlaeflarqpqvelihypglasfpqytlarqq
msqpggmiafelkggigagrrfmnalqlfsravslgdaeslaqhpasmthssytpeerah
ygiseglvrlsvglediddlladvqqalkasa

SCOPe Domain Coordinates for d3vk2c_:

Click to download the PDB-style file with coordinates for d3vk2c_.
(The format of our PDB-style files is described here.)

Timeline for d3vk2c_: